Recombinant Human CXCL13/BLC Protein, E. coli

Artikelnummer: ABB-RP02839
Artikelname: Recombinant Human CXCL13/BLC Protein, E. coli
Artikelnummer: ABB-RP02839
Hersteller Artikelnummer: RP02839
Alternativnummer: ABB-RP02839-100UG,ABB-RP02839-20UG
Hersteller: ABclonal
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Val23-Arg94
Alternative Synonym: ANGIE, ANGIE2, BCA-1, BCA1, BLC, BLR1L, SCYB13,CXCL13
The chemokine CXCL13, also known as BCA-1 (B-cell-attracting chemokine-1) or BLC (B-lymphocyte chemoattractant), which belongs to the CXC chemokine family. CXCL13 and its receptor CXCR5 control the organization of B cells within follicles of lymphoid tissues. CXCL13 is known to dictate homing and motility of B cells in lymphoid tissue and has been implicated in the formation of ectopic lymphoid tissue in chronic inflammation. It involves in B-cell compartmental homing within secondary lymphoid organs and recently implicated in the pathogenesis of inflammatory and malignant lymphocyte-mediated diseases. In Primary central nervous system lymphoma (PCNSL), expression of BCA-1 by malignant lymphocytes and vascular endothelium may influence tumor development and localization to central nervous system (CNS). In T-lymphocytes, CXCL13 expression is thought to reflect a germinal center origin of the T-cell. CXCL13 expression may also provide an additional useful tool for the diagnosis of Angioimmunoblastic T-cell lymphoma (AITL).
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 8.8 kDa
Tag: No tag
NCBI: 10563
UniProt: O43927
Quelle: E. coli
Reinheit: 95 % as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.22 µm filtered solution of 50 mM Tris, 0.5 M NaCl, pH 7.5.
Sequenz: VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKR
Target-Kategorie: CXCL13/BLC
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of 50 mM Tris, 0.5 M NaCl, pH 7.5.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Cytokines & Cytokine receptors
Recombinant Human CXCL13/BLC Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.