Recombinant Mouse Midkine/MDK Protein, E. coli

Artikelnummer: ABB-RP02865
Artikelname: Recombinant Mouse Midkine/MDK Protein, E. coli
Artikelnummer: ABB-RP02865
Hersteller Artikelnummer: RP02865
Alternativnummer: ABB-RP02865-100UG,ABB-RP02865-20UG,ABB-RP02865-10UG,ABB-RP02865-50UG
Hersteller: ABclonal
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Immunogen: Lys23-Asp140
Alternative Synonym: MK, ARAP, MDK, MEK, MK1, MKARAP, NEGF2
Midkine is a heparin-binding growth factor, originally reported as the product of a retinoic acid-responsive gene during embryogenesis, but currently viewed as a multifaceted factor contributing to both normal tissue homeostasis and disease development. Midkine is abnormally expressed at high levels in various human malignancies and acts as a mediator for the acquisition of critical hallmarks of cancer, including cell growth, survival, metastasis, migration, and angiogenesis.
Konzentration: < 0.1 EU/µg of the protein by LAL method.
Molekulargewicht: 13.08 kDa
NCBI: 17242
UniProt: P12025
Reinheit: 95 % as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.2 µm filtered solution of PBS, pH 7.4.
Sequenz: KKKEKVKKGSECSEWTWGPCTPSSKDCGMGFREGTCGAQTQRVHCKVPCNWKKEFGADCKYKFESWGACDGSTGTKARQGTLKKARYNAQCQETIRVTKPCTSKTKSKTKAKKGKGKD
Target-Kategorie: Midkine
Application Verdünnung: Lyophilized from a 0.2 µm filtered solution of PBS, pH 7.4.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Cytokines & Cytokine receptors