Recombinant Mouse Leptin/LEP Protein, E. coli

Artikelnummer: ABB-RP02880
Artikelname: Recombinant Mouse Leptin/LEP Protein, E. coli
Artikelnummer: ABB-RP02880
Hersteller Artikelnummer: RP02880
Alternativnummer: ABB-RP02880-100UG
Hersteller: ABclonal
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Immunogen: Val22-Cys167
Alternative Synonym: FLJ94114, LEP, leptin (murine obesity homolog), leptin (obesity homolog, mouse), Leptin, OB, Obese protein, obese, mouse, homolog of, Obesity factor, OBOBS
Leptin is a protein product of the mouse obese gene. Mice with mutations in the obese gene that block the synthesis of Leptin have been found to be obese and diabetic and to have reduced activity, metabolism and body temperature. cDNA clones encoding Leptin have been isolated from human, simian, mouse and rat cells. Mouse Leptin shares approximately 96% and 84% sequence identity with the rat and human protein, respectively. Mouse Leptin cDNA encodes a 167 amino acid residue protein with a 21 amino acid residue signal sequence that is cleaved to yield the 146 amino acid residue mature protein. The expression of Leptin mRNA has been shown to be restricted to adipose tissue. A high-affinity receptor for Leptin (OB-R) with homology to gp130 and the G-CSF receptor has been cloned. OB-R mRNA has been shown to be expressed in the choroid plexus and in the hypothalamus. OB-R has also been identified as an isoform of B219, a sequence that is expressed in at least four isoforms in very primitive hematopoietic cell populations and in a variety of lymphohematopoietic cell lines (1-3). The possible roles of Leptin in body weight regulation, hematopoiesis and reproduction are being investigated.
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 16.00 kDa
NCBI: 16846
UniProt: P41160
Reinheit: 95 % as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.22 µm filtered solution of 20mM PB, 300mM NaCl, pH7.4.
Sequenz: VPIQKVQDDTKTLIKTIVTRINDISHTQSVSAKQRVTGLDFIPGLHPILSLSKMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLHLLAFSKSCSLPQTSGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDVSPEC
Target-Kategorie: Leptin/LEP
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of 20mM PB, 300mM NaCl, pH7.4.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein