Recombinant Mouse IL-22 Protein, Human

Artikelnummer: ABB-RP02942
Artikelname: Recombinant Mouse IL-22 Protein, Human
Artikelnummer: ABB-RP02942
Hersteller Artikelnummer: RP02942
Alternativnummer: ABB-RP02942-20UG,ABB-RP02942-10UG,ABB-RP02942-100UG,ABB-RP02942-50UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Immunogen: Leu34-Val179
Alternative Synonym: IL-22, If2b1, Iltif, IL-22a, ILTIFa
Interleukin-22 (IL-22) was initially identified as a gene induced by IL-9 in mouse T cells and mast cells. Mouse IL-22 cDNA encodes a 179 amino acid residue protein with a putative 33 amino acid signal peptide that is cleaved to generate a 147 amino acid mature protein that shares approximately 79% and 22% sequence identity with human IL22 and IL10, respectively. IL22 has been shown to activate STAT-1 and STAT-3 in several hepatoma cell lines and up-regulate the production of acute phase proteins. IL-22 is produced by normal mouse T cells upon Con A activation. Mouse IL-22 expression is also induced in various organs upon lipopolysaccharide injection, suggesting that IL-22 may be involved in inflammatory responses. The functional IL-22 receptor complex consists of two receptor subunits, IL-22R (previously an orphan receptor named CRF2-9) and IL-10Rbeta (previously known as CRF2-4), belonging to the class II cytokine receptor family.
Konzentration: < 0.01 EU/µg of the protein by LAL method
Molekulargewicht: 17.48 kDa
Tag: C-His
NCBI: 50929
UniProt: Q9JJY9
Quelle: HEK293 cells
Reinheit: 95 % as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Sequenz: LPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV
Target-Kategorie: IL-22
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Anwendungsbeschreibung: Cross-Reactivity: Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. ResearchArea: Cytokines & Cytokine receptors