Recombinant Human ENPP-1 Protein

Produktübersicht

• Artikelname: Recombinant Human ENPP-1 Protein
• Artikelnummer: ABB-RP02960
• Hersteller Artikelnummer: RP02960
• Alternativnummer: ABB-RP02960-100UG,ABB-RP02960-50UG,ABB-RP02960-20UG,ABB-RP02960-10UG
• Hersteller: ABclonal
• Wirt: Human
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Immunogen: Lys98-Asp925
• Alternative Synonym: ENPP1,ARHR2,COLED,M6S1,NPP1,NPPS,PC-1,PCA1,PDNP1

Produktbeschreibung

Ectonucleotide pyrophosphatase/phosphodiesterase (ENPP)-1 is a membrane-bound protein that catalyzes the hydrolysis of extracellular nucleoside triphosphates to monophosphate and extracellular inorganic pyrophosphate (ePPi). Mechanical stimulation regulates ENPP-1 expression.

Produkteigenschaften

• Konzentration: < 0.01 EU/µg of the protein by LAL method
• Molekulargewicht: 95.95 kDa
• Tag: C-His
• NCBI: 5167
• UniProt: P22413
• Quelle: HEK293 cells
• Reinheit: 90% as determined by SDS-PAGE.
• Formulierung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
• Sequenz: KPSCAKEVKSCKGRCFERTFGNCRCDAACVELGNCCLDYQETCIEPEHIWTCNKFRCGEKRLTRSLCACSDDCKDKGDCCINYSSVCQGEKSWVEEPCESINEPQCPAGFETPPTLLFSLDGFRAEYLHTWGGLLPVISKLKKCGTYTKNMRPVYPTKTFPNHYSIVTGLYPESHGIIDNKMYDPKMNASFSLKSKEKFNPEWYKGEPIWVTAKYQGLKSGTFFWPGSDVEINGIFPDIYKMYNGSVPFEERILA
• Target-Kategorie: ENPP1

Anwendungsbeschreibung

• Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
• Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein