Recombinant Human Microfibrillar-associated protein 5 Protein

Produktübersicht

• Artikelname: Recombinant Human Microfibrillar-associated protein 5 Protein
• Artikelnummer: ABB-RP02966
• Hersteller Artikelnummer: RP02966
• Alternativnummer: ABB-RP02966-100UG
• Hersteller: ABclonal
• Wirt: Human
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Immunogen: Met1-Leu173
• Alternative Synonym: AAT9 , MAGP-2 , MAGP2 , MFAP-5, MP25

Produktbeschreibung

MFAP5 (Microfibril Associated Protein 5, also known as MAGP2) is a Protein Coding gene. MFAP5 is a component of the elastin-associated microfibrils. It belongs to the MFAP family. As a 25-kD microfibril-associated glycoprotein, MFAP5 is rich in serine and threonine residues. It stimulates the assembly of elastic fibers, a complex structure composed of a tropoelastin inner core and microfibril outer mantle comprising proteins such as fibrillins and microfibril-associated glycoproteins that guide tropoelastin deposition. MFAP5 also stabilizes type 1 procollagen and thus plays an important role in extracellular matrix homeostasis. It has multiple binding regions on fibrillins and has a covalent periodic association with fibrillin-containing microfibrils. Diseases associated with MFAP5 include Aortic Aneurysm, Familial Thoracic 9, and Familial Thoracic Aortic Aneurysm And Aortic Dissection.

Produkteigenschaften

• Konzentration: < 1 EU/µg of the protein by LAL method.
• Molekulargewicht: 18.7 kDa
• Tag: C-His
• NCBI: 8076
• UniProt: Q13361
• Quelle: HEK293 Cells
• Reinheit: 85 % as determined by SDS-PAGE.
• Formulierung: Lyophilized from sterile PBS, pH 7.4
• Sequenz: MSLLGPKVLLFLAAFIITSDWIPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL
• Target-Kategorie: Microfibrillar-associated protein 5

Anwendungsbeschreibung

• Application Verdünnung: Lyophilized from sterile PBS, pH 7.4
• Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein