Recombinant Human COX-2 Protein, Virus

Artikelnummer: ABB-RP02992
Artikelname: Recombinant Human COX-2 Protein, Virus
Artikelnummer: ABB-RP02992
Hersteller Artikelnummer: RP02992
Alternativnummer: ABB-RP02992-50UG
Hersteller: ABclonal
Wirt: Virus
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Met 1-Leu 604
Alternative Synonym: COX-2, COX2, GRIPGHS, hCox-2, PGGHS, PGHS-2, PHS-2
PTGS2, also known as COX-2, is s component of Prostaglandin-endoperoxide synthase (PTGS). PTGS, also known as cyclooxygenase, is the key enzyme in prostaglandin biosynthesis, and acts both as a dioxygenase and as a peroxidase. There are two isozymes of PTGS: a constitutive PTGS1 and an inducible PTGS2, which differ in their regulation of expression and tissue distribution. PTGS2 is overexpressed in many cancers. The overexpression of PTGS2 along with increased angiogenesis and GLUT-1 expression is significantly associated with gallbladder carcinomas. Furthermore the product of COX-2, PGH2 is converted by prostaglandin E2 synthase into PGE2, which in turn can stimulate cancer progression. Consequently inhibiting COX-2 may have benefit in the prevention and treatment of these types of cancer. PTGS2 is regulated by specific stimulatory events, suggesting that it is responsible for the prostanoid biosynthesis involved in inflammation and mitogenesis. It mediates the formation of prostaglandins from arachidonate and may have a role as a major mediator of inflammation and/or a role for prostanoid signaling in activity-dependent plasticity.
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 68.5 kDa
Tag: C-His
NCBI: 5743
UniProt: P35354
Quelle: Baculovirus-Insect Cells
Reinheit: 90 % as determined by SDS-PAGE.
Formulierung: Lyophilized from sterile 50mM Tris, 100mM NaCl, 0.5mM PMSF, 10% glycerol, pH 8.0.
Sequenz: MLARALLLCAVLALSHTANPCCSHPCQNRGVCMSVGFDQYKCDCTRTGFYGENCSTPEFLTRIKLFLKPTPNTVHYILTHFKGFWNVVNNIPFLRNAIMSYVLTSRSHLIDSPPTYNADYGYKSWEAFSNLSYYTRALPPVPDDCPTPLGVKGKKQLPDSNEIVEKLLLRRKFIPDPQGSNMMFAFFAQHFTHQFFKTDHKRGPAFTNGLGHGVDLNHIYGETLARQRKLRLFKDGKMKYQIIDGEMYPPTVKDT
Target-Kategorie: PTGS2
Application Verdünnung: Lyophilized from sterile 50mM Tris, 100mM NaCl, 0.5mM PMSF, 10% glycerol, pH 8.0.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. It is recommended that sterile water (200uL) be added to the vial to prepare a stock solution of 0.25mg/mL. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein