Recombinant Human ERAP2 Protein

Artikelnummer: ABB-RP03147LQ
Artikelname: Recombinant Human ERAP2 Protein
Artikelnummer: ABB-RP03147LQ
Hersteller Artikelnummer: RP03147LQ
Alternativnummer: ABB-RP03147LQ-50UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Ala56-Thr960
Alternative Synonym: Endoplasmic reticulum aminopeptidase 2, Leukocyte-derived arginine aminopeptidase, L-RAP, ERAP2, LRAP
Leukocyte-derived arginine aminopeptidase (LRAP), also known as endoplasmic reticulum-aminopeptidase 2 (ERAP2), is the second identified aminopeptidase localized in the in the lumenal side of endoplasmic reticulum (ER) processing antigenic peptides presented to major histocompatibility complex (MHC) class I molecules. It is a 96-amino acid protein with significant homology to placental leucine aminopeptidase and adipocyte-derived leucine aminopeptidase. LRAP preferentially hydrolyzes the basic residues Arg and Lys, and contains the HEXXH(X)18E zinc-binding motif, which is the characteristic of the M1 family of zinc metallopeptidases which also includes PILS/ARTS1/ERAP1 and LNPEP/PLAP. Induced by interferon-gamma, LRAP is able to trim various MHC class I antigenic peptide precursors.
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 115-125 kDa.
Tag: N-His
NCBI: 64167
UniProt: Q6P179
Quelle: HEK293 cells
Reinheit: 95 % as determined by SDS-PAGE.
Formulierung: Supplied as a 0.22 µm filtered solution in 12.5mM Tris, 75mM NaCl, pH 7.5, 50% glycercol. Contact us for customized product form or formulation.
Sequenz: ATNGERFPWQELRLPSVVIPLHYDLFVHPNLTSLDFVASEKIEVLVSNATQFIILHSKDLEITNATLQSEEDSRYMKPGKELKVLSYPAHEQIALLVPEKLTPHLKYYVAMDFQAKLGDGFEGFYKSTYRTLGGETRILAVTDFEPTQARMAFPCFDEPLFKANFSIKIRRESRHIALSNMPKVKTIELEGGLLEDHFETTVKMSTYLVAYIVCDFHSLSGFTSSGVKVSIYASPDKRNQTHYALQASLKLLDFY
Target-Kategorie: ERAP2
Application Verdünnung: Supplied as a 0.22 µm filtered solution in 12.5mM Tris, 75mM NaCl, pH 7.5, 50% glycercol. Contact us for customized product form or formulation.
Anwendungsbeschreibung: ResearchArea: Other Recombinant Protein
Recombinant Human ERAP2 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.