Recombinant Mouse CXCL4/PF-4 Protein, Human

Artikelnummer: ABB-RP03170
Artikelname: Recombinant Mouse CXCL4/PF-4 Protein, Human
Artikelnummer: ABB-RP03170
Hersteller Artikelnummer: RP03170
Alternativnummer: ABB-RP03170-10UG,ABB-RP03170-20UG,ABB-RP03170-100UG,ABB-RP03170-50UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Immunogen: Val30-Ser105
Alternative Synonym: Pf4, Cxcl4, Scyb4, Platelet factor 4, PF-4, C-X-C motif chemokine 4
Platelet factor-4 is a 70-amino acid protein that is released from the alpha-granules of activated platelets and binds with high affinity to heparin. Its major physiologic role appears to be neutralization of heparin-like molecules on the endothelial surface of blood vessels, thereby inhibiting local antithrombin III activity and promoting coagulation. As a strong chemoattractant for neutrophils and fibroblasts, PF4 probably has a role in inflammation and wound repair.
Konzentration: < 0.01 EU/µg of the protein by LAL method
Molekulargewicht: 34.17 kDa
NCBI: 56744
UniProt: Q9Z126
Reinheit: 90% as determined by SDS-PAGE, 90% as determined by HPLC.
Formulierung: Lyophilized from 0.22 µm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
Sequenz: VTSAGPEESDGDLSCVCVKTISSGIHLKHITSLEVIKAGRHCAVPQLIATLKNGRKICLDRQAPLYKKVIKKILES
Target-Kategorie: CXCL4
Application Verdünnung: Lyophilized from 0.22 µm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Cytokines & Cytokine receptors,Cell Culture related