Recombinant Mouse FGF-7/HBGF-7/KGF Protein, E. coli

Artikelnummer: ABB-RP03172
Artikelname: Recombinant Mouse FGF-7/HBGF-7/KGF Protein, E. coli
Artikelnummer: ABB-RP03172
Hersteller Artikelnummer: RP03172
Alternativnummer: ABB-RP03172-100UG,ABB-RP03172-10UG,ABB-RP03172-50UG,ABB-RP03172-20UG
Hersteller: ABclonal
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Immunogen: Cys32-Thr194
Alternative Synonym: Fibroblast growth factor 7,FGF-7,Heparin-binding growth factor 7,Keratinocyte growth factor,Fgf7,Fgf-7, Kgf
Fibroblast growth factor 7 (FGF7) is a member of the fibroblast growth factor (FGF) family of proteins. FGF7 plays an important role in regulating the proliferation, migration, and differentiation of cells. FGF7 is of stromal origin and produces a paracrine effect on epithelial cells. FGF7 is a mesenchyme-specific heparin-binding growth factor that binds FGF receptor 2 (FGFR2) to regulate numerous cellular and physiological processes. FGF7/FGFR2 promotes invasion and migration in human gastric cancer. FGF7 is specifically utilized as a paracrine factor during the process of differentiation of the epidermal layers in the regenerating scales and in particular for beta-cells differentiation. FGF7 over expression is associated with advanced clinical features in patients with upper tract and bladder urothelial carcinoma, justifying its potential prognostic value for urothelial carcinoma.
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 18.75 kDa
NCBI: 14178
UniProt: P36363
Reinheit: 95 % as determined by SDS-PAGE.
Formulierung: Lyophilized from 0.22 µm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
Sequenz: CNDMSPEQTATSVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNSYNIMEIRTVAVGIVAIKGVESEYYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHSGGEMFVALNQKGIPVKGKKTKKEQKTAHFLPMAIT
Target-Kategorie: FGF7
Application Verdünnung: Lyophilized from 0.22 µm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Cytokines & Cytokine receptors,Cell Culture related