Recombinant Human ABHD4 Protein, Virus

Artikelnummer: ABB-RP03195
Artikelname: Recombinant Human ABHD4 Protein, Virus
Artikelnummer: ABB-RP03195
Hersteller Artikelnummer: RP03195
Alternativnummer: ABB-RP03195-100UG,ABB-RP03195-20UG
Hersteller: ABclonal
Wirt: Virus
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Met1-Asp342
Alternative Synonym: ABHD4,(Lyso)-N-acylphosphatidylethanolamine lipase, 3.1.1.-, Alpha/beta hydrolase domain-containing protein 4, Abhydrolase domain-containing protein 4, Alpha/beta-hydrolase 4
Abhydrolase domain containing 4 (ABHD4), also known as alpha/beta-hydrolase 4 (ABH4) , or lyso-N-acylphosphatidylethanolamine lipase, which belongs to the ABHD4/ABHD5 subfamily of peptidase S33 family. Abhydrolase domain containing (ABHD) gene was a small group belongs to alpha/beta hydrolase superfamily. Known members of this group are all found to be involved in important biochemical processes and related to various diseases. The alpha/beta-hydrolase 4 (ABH4) is a lysophospholipase/phospholipase B that selectively hydrolyzes N-acyl phosphatidylethanolamines (NAPEs) and lysoNAPEs. ABH4 accepts lysoNAPEs bearing both saturated and polyunsaturated N-acyl chains as substrates and displays a distribution that closely mirrors lysoNAPE-lipase activity in mouse tissues. The existence of an NAPE-PLD-independent route for NAE biosynthesis and suggest that ABH4 plays a role in this metabolic pathway by acting as a (lyso)NAPE-selective lipase.
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 40 kDa.
Tag: N-His
NCBI: 63874
UniProt: Q8TB40
Quelle: Baculovirus-Insect Cells
Reinheit: 80% as determined by SDS-PAGE.
Formulierung: Lyophilized from sterile 50mM Tris, 100mM NaCl, pH 8.0.
Sequenz: MADDLEQQSQGWLSSWLPTWRPTSMSQLKNVEARILQCLQNKFLARYVSLPNQNKIWTVTVSPEQNDRTPLVMVHGFGGGVGLWILNMDSLSARRTLHTFDLLGFGRSSRPAFPRDPEGAEDEFVTSIETWRETMGIPSMILLGHSLGGFLATSYSIKYPDRVKHLILVDPWGFPLRPTNPSEIRAPPAWVKAVASVLGRSNPLAVLRVAGPWGPGLVQRFRPDFKRKFADFFEDDTISEYIYHCNAQNPSGETA
Target-Kategorie: ABHD4
Application Verdünnung: Lyophilized from sterile 50mM Tris, 100mM NaCl, pH 8.0.
Anwendungsbeschreibung: ResearchArea: Other Recombinant Protein