Recombinant Human NUDT5 Protein, E. coli

Artikelnummer: ABB-RP03258
Artikelname: Recombinant Human NUDT5 Protein, E. coli
Artikelnummer: ABB-RP03258
Hersteller Artikelnummer: RP03258
Alternativnummer: ABB-RP03258-100UG
Hersteller: ABclonal
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Met1-Phe219
Alternative Synonym: NUDT5, NUDIX5, HSPC115, ADP-sugar pyrophosphatase, Nudix motif 5, YSA1H, YSA1
NUDIX hydrolase type 5 (NUDT5) is a kind of ADP-ribose pyrophosphatase and nucleotide metabolizing enzyme that can either act as an ADP-sugar pyrophosphatase in absence of diphosphate or catalyze the synthesis of ATP in presence of diphosphate. In absence of diphosphate, NUDT5 hydrolyzes with similar activities various modified nucleoside diphosphates such as ADP-ribose, ADP-mannose, ADP-glucose, 8-oxo-GDP and 8-oxo-dGDP. In presence of diphosphate, NUDT5 mediates the synthesis of ATP in the nucleus by catalyzing the conversion of ADP-ribose to ATP and ribose 5-phosphate.
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 25.29 kDa
NCBI: 11164
UniProt: Q9UKK9
Reinheit: 95 % as determined by Tris-Bis PAGE, 95 % as determined by HPLC.
Formulierung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Sequenz: MESQEPTESSQNGKQYIISEELISEGKWVKLEKTTYMDPTGKTRTWESVKRTTRKEQTADGVAVIPVLQRTLHYECIVLVKQFRPPMGGYCIEFPAGLIDDGETPEAAALRELEEETGYKGDIAECSPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHANAKPFEVPFLKF
Target-Kategorie: NUDT5
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein