Recombinant Human IgG3 Protein

Artikelnummer: ABB-RPT0006
Artikelname: Recombinant Human IgG3 Protein
Artikelnummer: ABB-RPT0006
Hersteller Artikelnummer: RPT0006
Alternativnummer: ABB-RPT0006-100UG, ABB-RPT0006-50UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Glu99-Lys377
Alternative Synonym: IgG3
IGHG3 (Immunoglobulin Heavy Constant Gamma 3 (G3m Marker), also known as IgG3) is a Protein Coding gene. Ig gamma-3 chain C region is a protein that in humans is encoded by the IGHG3 gene. Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins-secreting plasma cells. Murine immunoglobulin G (IgG) plays an important role in mediating protective immune responses to malaria. Diseases associated with IGHG3 include Heavy Chain Disease and Gamma Heavy Chain Disease. Among its related pathways are IL4-mediated signaling events and the Creation of C4 and C2 activators.
Konzentration: < 0.1 EU/µg of the protein by LAL method.
Molekulargewicht: 31.21 kDa
NCBI: 3502
UniProt: P01860
Reinheit: 90 % as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Sequenz: ELKTPLGDTTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFKWYVDGVEVHNAKTKPREEQYNSTFRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSKLTVDKSRWQQGNIF
Target-Kategorie: IgG3
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Tool proteins