Recombinant Mouse IgG2C Protein, Human

Produktübersicht

• Artikelname: Recombinant Mouse IgG2C Protein, Human
• Artikelnummer: ABB-RPT0024
• Hersteller Artikelnummer: RPT0024
• Alternativnummer: ABB-RPT0024-100UG
• Hersteller: ABclonal
• Wirt: Human
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Mouse
• Immunogen: Glu98-Lys335
• Alternative Synonym: Immunoglobulin heavy constant gamma 2C ,Ighg2c

Produktbeschreibung

Mouse IgG2c is a subclass of mouse antibody IgG, it can bind FcgammaRIV with high affinity and the Fc loop residues of mouse IgG2c promote greater receptor-binding affinity than mouse IgG2b or human IgG1.

Produkteigenschaften

• Konzentration: < 1 EU/µg of the protein by LAL method.
• Molekulargewicht: 27.23 kDa
• NCBI: 404711
• UniProt: F6TQW2
• Reinheit: 95 % as determined by SDS-PAGE.
• Formulierung: Lyophilized from 0.22 µm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
• Sequenz: ESRRPIPPNSCPPCKECSIFPAPDLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNRALPSPIEKTISKPRGPVRAPQVYVLPPPAEEMTKKEFSLTCMITDFLPAEIAVDWTSNGHKELNYKNTAPVLDTDGSYFMYSKLRVQKSTWEKGSLFACSVVHEGLHNHHTTKTISRSLGK
• Target-Kategorie: Ighg2c

Anwendungsbeschreibung

• Application Verdünnung: Lyophilized from 0.22 µm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
• Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein