Recombinant Yeast ULP1/SUMO protease, E. coli

Artikelnummer: ABB-RPT0029LQ
Artikelname: Recombinant Yeast ULP1/SUMO protease, E. coli
Artikelnummer: ABB-RPT0029LQ
Hersteller Artikelnummer: RPT0029LQ
Alternativnummer: ABB-RPT0029LQ-200U,ABB-RPT0029LQ-1000U
Hersteller: ABclonal
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Yeast
Immunogen: Leu403-Lys621
Alternative Synonym: ULP1, YPL020C, LPB11C,Ubiquitin-like-specific protease 1
Ulp1 is a protease which is naturally present in yeast and specifically cleaves Ubl proteins (ubiquitin-like proteins) such as SUMO1 and Smt3 from other proteins. Ulp1 is a valuable tool in molecular biology for cleaving SUMO-tags from recombinant proteins.
Konzentration: < 0.01 EU/µg of the protein by LAL method
Molekulargewicht: 26.31 kDa
NCBI: 856087
UniProt: Q02724
Reinheit: 90% as determined by SDS-PAGE.
Formulierung: Supplied as 0.22 µm filtered solution in 20mM Tris,150mM NaCl,50% glycerol,pH8.0
Sequenz: LVPELNEKDDDQVQKALASRENTQLMNRDNIEITVRDFKTLAPRRWLNDTIIEFFMKYIEKSTPNTVAFNSFFYTNLSERGYQGVRRWMKRKKTQIDKLDKIFTPINLNQSHWALGIIDLKKKTIGYVDSLSNGPNAMSFAILTDLQKYVMEESKHTIGEDFDLIHLDCPQQPNGYDCGIYVCMNTLYGSADAPLDFDYKDAIRMRRFIAHLILTDALK
Target-Kategorie: ULP1, YPL020C, LPB11C
Application Verdünnung: Supplied as 0.22 µm filtered solution in 20mM Tris,150mM NaCl,50% glycerol,pH8.0
Anwendungsbeschreibung: ResearchArea: Other Recombinant Protein