Recombinant Cynomolgus IgE Protein, Human

Produktübersicht

• Artikelname: Recombinant Cynomolgus IgE Protein, Human
• Artikelnummer: ABB-RPT0037
• Hersteller Artikelnummer: RPT0037
• Alternativnummer: ABB-RPT0037-20UG,ABB-RPT0037-100UG,ABB-RPT0037-50UG
• Hersteller: ABclonal
• Wirt: Human
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Monkey
• Immunogen: Lys208-Lys429
• Alternative Synonym: Ig-like domain-containing protein ,EGM_20642,IgE

Produktbeschreibung

IgE protein is an important immunoglobulin component that participates in the recognition and effector phases of humoral immunity. As a membrane-bound receptor on B lymphocytes, IgE triggers clonal expansion upon antigen binding, leading to plasma cell differentiation.

Produkteigenschaften

• Konzentration: < 0.1 EU/µg of the protein by LAL method.
• Molekulargewicht: 27.45 kDa
• UniProt: G8F4W7
• Reinheit: 90 % as determined by SDS-PAGE.
• Formulierung: Lyophilized from 0.22µm filtered solution in PBS (pH 7.4).
• Sequenz: KCADSNPRGVSAYLSRPSPFDLFISKSPTITCLVVDLAPSKETVNLTWSRASGKPVPHIPATEKKQQRNGTLTVTSILPVVTQDWIEGETYQCRVIHPHLPRALVRSMTKTSGPRAAPEVYVFATPEKLESRDKRTLACLIENFMPEDISVQWLHSDVQLPDTRHSVTQPRKTKGSGFFVFSRLEVTKAEWEQKDEFICRAVHEAASPSWIVQQAVSVNPGK
• Target-Kategorie: IgE

Anwendungsbeschreibung

• Application Verdünnung: Lyophilized from 0.22µm filtered solution in PBS (pH 7.4).
• Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein