Anti-RECQL4 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A10010-100
Artikelname: Anti-RECQL4 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A10010-100
Hersteller Artikelnummer: A10010-100
Alternativnummer: ABC-A10010-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 231-330 of human RECQL4 (NP_004251.3).
Konjugation: Unconjugated
Rabbit polyclonal antibody to RECQL4.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 140 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: GAGSQGPEASAFQEVSIRVGSPQPSSSGGEKRRWNEEPWESPAQVQQESSQAGPPSEGAGAVAVEEDPPGEPVQAQPPQPCSSPSNPRYHGLSPSSQARA
Target-Kategorie: RECQL4
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000