Anti-Poliovirus Receptor/PVR Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A11872-100
Artikelname: Anti-Poliovirus Receptor/PVR Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A11872-100
Hersteller Artikelnummer: A11872-100
Alternativnummer: ABC-A11872-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 60-190 of human CD155/PVR (NP_006496.4).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Poliovirus Receptor/PVR.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 70 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: HVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTS
Target-Kategorie: Poliovirus Receptor/PVR
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:100-1:500