Anti-Influenza Virus NS1A Binding Protein Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A14566-100
Artikelname: Anti-Influenza Virus NS1A Binding Protein Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A14566-100
Hersteller Artikelnummer: A14566-100
Alternativnummer: ABC-A14566-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human IVNS1ABP (NP_006460.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Influenza Virus NS1A Binding Protein.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 72 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: MIPNGYLMFEDENFIESSVAKLNALRKSGQFCDVRLQVCGHEMLAHRAVLACCSPYLFEIFNSDSDPHGISHVKFDDLNPEAVEVLLNYAYTAQLKADKELVKDVYSAAKKLKMDRVKQVCGDYLLSRMDVTSCISYRNFASCMGDSRLLNKVDAYIQEHLLQISEEEEFLKLPRLKLEVMLEDNVCLPSNGKLYTKVINWVQRSIWENGDSLEELMEEVQTLYYSADHKLLDGNLLDGQAEVFGSDDDHIQFVQ
Target-Kategorie: Influenza Virus NS1A Binding Protein
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000