Anti-SARS-CoV-2 Spike Glycoprotein S2 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A305449-100
Artikelname: Anti-SARS-CoV-2 Spike Glycoprotein S2 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A305449-100
Hersteller Artikelnummer: A305449-100
Alternativnummer: ABC-A305449-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IP, WB
Spezies Reaktivität: Virus
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1174-1273 of SARS-CoV-2 Spike S2 (YP_009724390.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to SARS-CoV-2 Spike Glycoprotein S2.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 36 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Formulierung: Liquid
Sequenz: ASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT
Target-Kategorie: SARS-CoV-2 Spike Glycoprotein S2
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000, IP: 1:1,000-1:5,000