Anti-SARS-CoV-2 NSP12 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A306039-100
Artikelname: Anti-SARS-CoV-2 NSP12 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A306039-100
Hersteller Artikelnummer: A306039-100
Alternativnummer: ABC-A306039-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Virus
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of coronavirus NSP12 (YP_009725307.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to SARS-CoV-2 NSP12.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 100 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: GIVGVLTLDNQDLNGNWYDFGDFIQTTPGSGVPVVDSYYSLLMPILTLTRALTAESHVDTDLTKPYIKWDLLKYDFTEERLKLFDRYFKYWDQTYHPNCVN
Target-Kategorie: SARS-CoV-2 NSP12
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:2,000-1:6,000