Anti-Poliovirus Receptor/PVR Antibody [ARC1178], Unconjugated, Rabbit, Monoclonal
Artikelnummer:
ABC-A306161-100
| Artikelname: |
Anti-Poliovirus Receptor/PVR Antibody [ARC1178], Unconjugated, Rabbit, Monoclonal |
| Artikelnummer: |
ABC-A306161-100 |
| Hersteller Artikelnummer: |
A306161-100 |
| Alternativnummer: |
ABC-A306161-100 |
| Hersteller: |
Antibodies.com |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 250-350 of human CD155/PVR (P15151). |
| Konjugation: |
Unconjugated |
| Rabbit monoclonal [ARC1178] antibody to Poliovirus Receptor/PVR. |
| Klonalität: |
Monoclonal |
| Konzentration: |
Lot Specific |
| Klon-Bezeichnung: |
[ARC1178] |
| Molekulargewicht: |
70 kDa |
| Puffer: |
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide. |
| Formulierung: |
Liquid |
| Sequenz: |
GYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGISRNAIIFLVL |
| Target-Kategorie: |
Poliovirus Receptor/PVR |
| Antibody Type: |
Primary Antibody |
| Application Verdünnung: |
WB: 1:500-1:2,000 |
