Anti-Poliovirus Receptor/PVR Antibody [ARC1178], Unconjugated, Rabbit, Monoclonal

Artikelnummer: ABC-A306161-100
Artikelname: Anti-Poliovirus Receptor/PVR Antibody [ARC1178], Unconjugated, Rabbit, Monoclonal
Artikelnummer: ABC-A306161-100
Hersteller Artikelnummer: A306161-100
Alternativnummer: ABC-A306161-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 250-350 of human CD155/PVR (P15151).
Konjugation: Unconjugated
Rabbit monoclonal [ARC1178] antibody to Poliovirus Receptor/PVR.
Klonalität: Monoclonal
Konzentration: Lot Specific
Klon-Bezeichnung: [ARC1178]
Molekulargewicht: 70 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: GYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGISRNAIIFLVL
Target-Kategorie: Poliovirus Receptor/PVR
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000