Anti-PYCRL Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A306781-100
Artikelname: Anti-PYCRL Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A306781-100
Hersteller Artikelnummer: A306781-100
Alternativnummer: ABC-A306781-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 13-286 of human PYCRL (NP_075566.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to PYCRL.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 35 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: MAAAEPSPRRVGFVGAGRMAGAIAQGLIRAGKVEAQHILASAPTDRNLCHFQALGCRTTHSNQEVLQSCLLVIFATKPHVLPAVLAEVAPVVTTEHILVSVAAGVSLSTLEELLPPNTRVLRVLPNLPCVVQEGAIVMARGRHVGSSETKLLQHLLEACGRCEEVPEAYVDIHTGLSGSGVAFVCAFSEALAEGAVKMGMPSSLAHRIAAQTLLGTAKMLLHEGQHPAQLRSDVCTPGGTTIYGLHALEQGGLRA
Target-Kategorie: PYCRL
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000