Anti-CLPTM1 Antibody [ARC2720], Unconjugated, Rabbit, Monoclonal

Artikelnummer: ABC-A306784-100
Artikelname: Anti-CLPTM1 Antibody [ARC2720], Unconjugated, Rabbit, Monoclonal
Artikelnummer: ABC-A306784-100
Hersteller Artikelnummer: A306784-100
Alternativnummer: ABC-A306784-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CLPTM1 (O96005).
Konjugation: Unconjugated
Rabbit monoclonal [ARC2720] antibody to CLPTM1.
Klonalität: Monoclonal
Konzentration: Lot Specific
Klon-Bezeichnung: [ARC2720]
Molekulargewicht: 100 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: MAAAQEADGARSAVVAAGGGSSGQVTSNGSIGRDPPAETQPQNPPAQPAPNAWQVIKGVLFRIFIIWAISSWFRRGPAPQDQAGPGGAPRVASRNLFPKD
Target-Kategorie: CLPTM1
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:100-1:500