Anti-ATG7 Antibody [ARC0083], Unconjugated, Rabbit, Monoclonal

Artikelnummer: ABC-A306787-100
Artikelname: Anti-ATG7 Antibody [ARC0083], Unconjugated, Rabbit, Monoclonal
Artikelnummer: ABC-A306787-100
Hersteller Artikelnummer: A306787-100
Alternativnummer: ABC-A306787-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Atg7(Apg7) (O95352).
Konjugation: Unconjugated
Rabbit monoclonal [ARC0083] antibody to ATG7.
Klonalität: Monoclonal
Konzentration: Lot Specific
Klon-Bezeichnung: [ARC0083]
Molekulargewicht: 77 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: MAAATGDPGLSKLQFAPFSSALDVGFWHELTQKKLNEYRLDEAPKDIKGYYYNGDSAGLPARLTLEFSAFDMSAPTPARCCPAIGTLYNTNTLESFKTAD
Target-Kategorie: ATG7
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, IHC: 1:50-1:200, IP: 1:50-1:200