Anti-ERp29 Antibody [ARC2295], Unconjugated, Rabbit, Monoclonal

Artikelnummer: ABC-A306789-100
Artikelname: Anti-ERp29 Antibody [ARC2295], Unconjugated, Rabbit, Monoclonal
Artikelnummer: ABC-A306789-100
Hersteller Artikelnummer: A306789-100
Alternativnummer: ABC-A306789-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-102 of human ERp29 (P30040).
Konjugation: Unconjugated
Rabbit monoclonal [ARC2295] antibody to ERp29.
Klonalität: Monoclonal
Konzentration: Lot Specific
Klon-Bezeichnung: [ARC2295]
Molekulargewicht: 30 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: MAAAVPRAAFLSPLLPLLLGFLLLSAPHGGSGLHTKGALPLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNM
Target-Kategorie: ERp29
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, IHC: 1:50-1:200