Anti-Elongation factor 1-gamma Antibody [ARC1287], Unconjugated, Rabbit, Monoclonal

Artikelnummer: ABC-A306796-100
Artikelname: Anti-Elongation factor 1-gamma Antibody [ARC1287], Unconjugated, Rabbit, Monoclonal
Artikelnummer: ABC-A306796-100
Hersteller Artikelnummer: A306796-100
Alternativnummer: ABC-A306796-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-123 of human eEF1G (P26641).
Konjugation: Unconjugated
Rabbit monoclonal [ARC1287] antibody to Elongation factor 1-gamma.
Klonalität: Monoclonal
Konzentration: Lot Specific
Klon-Bezeichnung: [ARC1287]
Molekulargewicht: 50 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: MAAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVFESNAIAYYVSNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHH
Target-Kategorie: Elongation factor 1-gamma
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200