Anti-SARS-CoV-2 ORF6 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A307318-100
Artikelname: Anti-SARS-CoV-2 ORF6 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A307318-100
Hersteller Artikelnummer: A307318-100
Alternativnummer: ABC-A307318-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Virus
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-61 of coronavirus ORF6 (YP_009724394.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to SARS-CoV-2 ORF6.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 12 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Formulierung: Liquid
Sequenz: MFHLVDFQVTIAEILLIIMRTFKVSIWNLDYIINLIIKNLSKSLTENKYSQLDEEQPMEID
Target-Kategorie: SARS-CoV-2 ORF6
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000