Anti-SARS-CoV-2 Spike Glycoprotein S1 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A309131-100
Artikelname: Anti-SARS-CoV-2 Spike Glycoprotein S1 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A309131-100
Hersteller Artikelnummer: A309131-100
Alternativnummer: ABC-A309131-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: DOT, ICC, IP, WB
Spezies Reaktivität: Virus
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 11-682 of coronavirus Spike S1 (YP_009724390.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to SARS-CoV-2 Spike Glycoprotein S1.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 110 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: VSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAY
Target-Kategorie: SARS-CoV-2 Spike Glycoprotein S1
Antibody Type: Primary Antibody
Application Verdünnung: Dot Blot: 1:500-1:2,000, ELISA: 1:20,000-1:80,000, WB: 1:500-1:1,000, ICC/IF: 1:100-1:500, IP: 1:2,000-1:10,000