Recombinant Cynomolgus macaque SLITRK6 Protein (C-terminal 10xHis Tag), Unconjugated

Artikelnummer: ABC-A332985-50
Artikelname: Recombinant Cynomolgus macaque SLITRK6 Protein (C-terminal 10xHis Tag), Unconjugated
Artikelnummer: ABC-A332985-50
Hersteller Artikelnummer: A332985-50
Alternativnummer: ABC-A332985-50
Hersteller: Antibodies.com
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Konjugation: Unconjugated
Konzentration: Reconstitution dependent.
Molekulargewicht: 70-130 kDa due to glycosylation.
Tag: C-terminal 10xHis Tag
Puffer: Lyophilized from sterile Phosphate Buffered Saline, pH 7.4. Normally 5%-8% Trehalose is added as a protectant before lyophilization.
Expression System: HEK293 cells
Reinheit: >85% as determined by SDS-PAGE and Coomassie blue staining.
Formulierung: Lyophilized
Sequenz: QTPVFSVRSSCDSLCNCEEKDGTMLINCEEKGIKTVSEISVPPSRPFQLSLLNNGLTMLHTNDFSGLTNAISIHLGFNNIADIEIGAFNGLGLLKQLHINHNSLEILKEDTFHGLENLEFLQADNNFITVIEPSAFSKLNRLKVLILNDNAIESLPPNIFRFVPLTHLDLRGNQLQTLPYVGFLEHIGRILDLQLEDNKWACNCDLLQLKTWLENMPPQSIIGDVVCNSPPFFKGSVLSRLKKESICPTPPVYEE
Target-Kategorie: SLITRK6