Anti-IL-1RA Antibody [ARC0524], Unconjugated, Rabbit, Monoclonal

Artikelnummer: ABC-A80574-100
Artikelname: Anti-IL-1RA Antibody [ARC0524], Unconjugated, Rabbit, Monoclonal
Artikelnummer: ABC-A80574-100
Hersteller Artikelnummer: A80574-100
Alternativnummer: ABC-A80574-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human IL1RA (P18510).
Konjugation: Unconjugated
Rabbit monoclonal [ARC0524] antibody to IL-1RA.
Klonalität: Monoclonal
Konzentration: Lot Specific
Klon-Bezeichnung: [ARC0524]
Molekulargewicht: 22 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: ETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
Target-Kategorie: IL-1RA
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, ICC/IF: 1:50-1:200