Anti-PD-L1 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A80578-100
Artikelname: Anti-PD-L1 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A80578-100
Hersteller Artikelnummer: A80578-100
Alternativnummer: ABC-A80578-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-50 of human PD-L1/CD274 (NP_054862.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to PD-L1.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 40 - 50 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: MRIFAVFIFMTYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDL
Target-Kategorie: PD-L1
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:100-1:500, IHC: 1:50-1:200