Anti-Collagen X Antibody [ARC0659], Unconjugated, Rabbit, Monoclonal
Artikelnummer:
ABC-A80628-100
| Artikelname: |
Anti-Collagen X Antibody [ARC0659], Unconjugated, Rabbit, Monoclonal |
| Artikelnummer: |
ABC-A80628-100 |
| Hersteller Artikelnummer: |
A80628-100 |
| Alternativnummer: |
ABC-A80628-100 |
| Hersteller: |
Antibodies.com |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Mouse, Rat |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 500-600 of human Collagen X/COL10A1 (Q03692). |
| Konjugation: |
Unconjugated |
| Rabbit monoclonal [ARC0659] antibody to Collagen X. |
| Klonalität: |
Monoclonal |
| Konzentration: |
Lot Specific |
| Klon-Bezeichnung: |
[ARC0659] |
| Molekulargewicht: |
66 kDa |
| Puffer: |
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide. |
| Formulierung: |
Liquid |
| Sequenz: |
HSGEPGLPGPPGPPGPPGQAVMPEGFIKAGQRPSLSGTPLVSANQGVTGMPVSAFTVILSKAYPAIGTPIPFDKILYNRQQHYDPRTGIFTCQIPGIYYFS |
| Target-Kategorie: |
Collagen X |
| Antibody Type: |
Primary Antibody |
| Application Verdünnung: |
WB: 1:500-1:2,000 |
