Anti-Glyt2 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A80696-100
Artikelname: Anti-Glyt2 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A80696-100
Hersteller Artikelnummer: A80696-100
Alternativnummer: ABC-A80696-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human SLC6A5 (NP_004202.3).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Glyt2.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 60 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: MDCSAPKEMNKLPANSPEAAAAQGHPDGPCAPRTSPEQELPAAAAPPPPRVPRSASTGAQTFQSADARACEAERPGVGSCKLSSPRAQAASAALRDLREAQGAQASPPPGSSGPGNALHCKIPFLRGPEGDANVSVGKGTLERNNTPVVGWVNMSQSTVVLGTDGITSVLPGSVATVATQEDEQGDENKARGNWSSKLDF
Target-Kategorie: Glyt2
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000