Anti-IGFBP1 Antibody [ARC0671], Unconjugated, Rabbit, Monoclonal

Artikelnummer: ABC-A80700-100
Artikelname: Anti-IGFBP1 Antibody [ARC0671], Unconjugated, Rabbit, Monoclonal
Artikelnummer: ABC-A80700-100
Hersteller Artikelnummer: A80700-100
Alternativnummer: ABC-A80700-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 160-259 of human IGFBP1 (P08833).
Konjugation: Unconjugated
Rabbit monoclonal [ARC0671] antibody to IGFBP1.
Klonalität: Monoclonal
Konzentration: Lot Specific
Klon-Bezeichnung: [ARC0671]
Molekulargewicht: 30 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: GSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN
Target-Kategorie: IGFBP1
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000