Anti-CD41 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A80725-100
Artikelname: Anti-CD41 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A80725-100
Hersteller Artikelnummer: A80725-100
Alternativnummer: ABC-A80725-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, ICC
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to amino acids 160-260 of human CD41.
Konjugation: Unconjugated
Rabbit polyclonal antibody to CD41.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 113kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: SCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPE
Target-Kategorie: CD41
Antibody Type: Primary Antibody
Application Verdünnung: ICC/IF: 1:50-1:200