Anti-RANBP9 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A80737-100
Artikelname: Anti-RANBP9 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A80737-100
Hersteller Artikelnummer: A80737-100
Alternativnummer: ABC-A80737-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: A recombinant fusion protein corresponding to amino acids 480-605 of human RANBP9.
Konjugation: Unconjugated
Rabbit polyclonal antibody to RANBP9.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 100 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: PFSSPSMSPSHGMNIHNLASGKGSTAHFSGFESCSNGVISNKAHQSYCHSNKHQSSNLNVPELNSINMSRSQQVNNFTSNDVDMETDHYSNGVGETSSNGFLNGSSKHDHEMEDCDTEMEVDSSQL
Target-Kategorie: RANBP9
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000