Anti-IRF5 Antibody [ARC0525], Unconjugated, Rabbit, Monoclonal
Artikelnummer:
ABC-A80782-100
| Artikelname: |
Anti-IRF5 Antibody [ARC0525], Unconjugated, Rabbit, Monoclonal |
| Artikelnummer: |
ABC-A80782-100 |
| Hersteller Artikelnummer: |
A80782-100 |
| Alternativnummer: |
ABC-A80782-100 |
| Hersteller: |
Antibodies.com |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IP, WB |
| Spezies Reaktivität: |
Human, Mouse |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 6-151 of human IRF5 (Q13568). |
| Konjugation: |
Unconjugated |
| Rabbit monoclonal [ARC0525] antibody to IRF5. |
| Klonalität: |
Monoclonal |
| Konzentration: |
Lot Specific |
| Klon-Bezeichnung: |
[ARC0525] |
| Molekulargewicht: |
60 kDa |
| Puffer: |
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide. |
| Formulierung: |
Liquid |
| Sequenz: |
PVAPTPPRRVRLKPWLVAQVNSCQYPGLQWVNGEKKLFCIPWRHATRHGPSQDGDNTIFKAWAKETGKYTEGVDEADPAKWKANLRCALNKSRDFRLIYDGPRDMPPQPYKIYEVCSNGPAPTDSQPPEDYSFGAGEEEEEEEELQ |
| Target-Kategorie: |
IRF5 |
| Antibody Type: |
Primary Antibody |
| Application Verdünnung: |
WB: 1:500-1:2,000, IP: 1:100-1:500 |
