Anti-Myelin Basic Protein Antibody [ARC0535], Unconjugated, Rabbit, Monoclonal

Artikelnummer: ABC-A80785-100
Artikelname: Anti-Myelin Basic Protein Antibody [ARC0535], Unconjugated, Rabbit, Monoclonal
Artikelnummer: ABC-A80785-100
Hersteller Artikelnummer: A80785-100
Alternativnummer: ABC-A80785-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 161-304 of human Myelin Basic Protein (P02686).
Konjugation: Unconjugated
Rabbit monoclonal [ARC0535] antibody to Myelin Basic Protein.
Klonalität: Monoclonal
Konzentration: Lot Specific
Klon-Bezeichnung: [ARC0535]
Molekulargewicht: 14 - 23 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: GFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLGGRDSRSGSPMARR
Target-Kategorie: Myelin Basic Protein
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, ICC/IF: 1:50-1:200