Anti-NFkB p100/NFKB2 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A80786-100
Artikelname: Anti-NFkB p100/NFKB2 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A80786-100
Hersteller Artikelnummer: A80786-100
Alternativnummer: ABC-A80786-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 690-899 of human NF-?B2 (NP_002493.3).
Konjugation: Unconjugated
Rabbit polyclonal antibody to NFkB p100/NFKB2.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 125 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: AGADIHAENEEPLCPLPSPPTSDSDSDSEGPEKDTRSSFRGHTPLDLTCSTKVKTLLLNAAQNTMEPPLTPPSPAGPGLSLGDTALQNLEQLLDGPEAQGSWAELAERLGLRSLVDTYRQTTSPSGSLLRSYELAGGDLAGLLEALSDMGLEEGVRLLRGPETRDKLPSTEVKEDSAYGSQSVEQEAEKLGPPPEPPGGLCHGHPQPQVH
Target-Kategorie: NFkB p100/NFKB2
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, ICC/IF: 1:50-1:200