Anti-Aspartate Aminotransferase Antibody [ARC0579], Unconjugated, Rabbit, Monoclonal

Artikelnummer: ABC-A80801-100
Artikelname: Anti-Aspartate Aminotransferase Antibody [ARC0579], Unconjugated, Rabbit, Monoclonal
Artikelnummer: ABC-A80801-100
Hersteller Artikelnummer: A80801-100
Alternativnummer: ABC-A80801-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 150-250 of human GOT1 (P17174).
Konjugation: Unconjugated
Rabbit monoclonal [ARC0579] antibody to Aspartate Aminotransferase.
Klonalität: Monoclonal
Konzentration: Lot Specific
Klon-Bezeichnung: [ARC0579]
Molekulargewicht: 41 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: AAGFKDIRSYRYWDAEKRGLDLQGFLNDLENAPEFSIVVLHACAHNPTGIDPTPEQWKQIASVMKHRFLFPFFDSAYQGFASGNLERDAWAIRYFVSEGFE
Target-Kategorie: Aspartate Aminotransferase
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, ICC/IF: 1:50-1:200