Anti-Ionotropic Glutamate receptor 2 Antibody [ARC0572], Unconjugated, Rabbit, Monoclonal

Artikelnummer: ABC-A81034-100
Artikelname: Anti-Ionotropic Glutamate receptor 2 Antibody [ARC0572], Unconjugated, Rabbit, Monoclonal
Artikelnummer: ABC-A81034-100
Hersteller Artikelnummer: A81034-100
Alternativnummer: ABC-A81034-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 150-250 of human GluR2/GRIA2 (P42262).
Konjugation: Unconjugated
Rabbit monoclonal [ARC0572] antibody to Ionotropic Glutamate receptor 2.
Klonalität: Monoclonal
Konzentration: Lot Specific
Klon-Bezeichnung: [ARC0572]
Molekulargewicht: 99 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: YLYDSDRGLSTLQAVLDSAAEKKWQVTAINVGNINNDKKDEMYRSLFQDLELKKERRVILDCERDKVNDIVDQVITIGKHVKGYHYIIANLGFTDGDLLKI
Target-Kategorie: Ionotropic Glutamate receptor 2
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200