Anti-Angiotensin Converting Enzyme 1 Antibody [ARC0577], Unconjugated, Rabbit, Monoclonal
Artikelnummer:
ABC-A81038-100
| Artikelname: |
Anti-Angiotensin Converting Enzyme 1 Antibody [ARC0577], Unconjugated, Rabbit, Monoclonal |
| Artikelnummer: |
ABC-A81038-100 |
| Hersteller Artikelnummer: |
A81038-100 |
| Alternativnummer: |
ABC-A81038-100 |
| Hersteller: |
Antibodies.com |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IP, WB |
| Spezies Reaktivität: |
Mouse, Rat |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 1200-1306 of human ACE1 (P12821). |
| Konjugation: |
Unconjugated |
| Rabbit monoclonal [ARC0577] antibody to Angiotensin Converting Enzyme 1. |
| Klonalität: |
Monoclonal |
| Konzentration: |
Lot Specific |
| Klon-Bezeichnung: |
[ARC0577] |
| Molekulargewicht: |
170 kDa |
| Puffer: |
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide. |
| Formulierung: |
Liquid |
| Sequenz: |
YFKPLLDWLRTENELHGEKLGWPQYNWTPNSARSEGPLPDSGRVSFLGLDLDAQQARVGQWLLLFLGIALLVATLGLSQRLFSIRHRSLHRHSHGPQFGSEVELRHS |
| Target-Kategorie: |
Angiotensin Converting Enzyme 1 |
| Antibody Type: |
Primary Antibody |
| Application Verdünnung: |
WB: 1:500-1:2,000, IP: 1:500-1:1,000 |
