Anti-Angiotensin Converting Enzyme 1 Antibody [ARC0577], Unconjugated, Rabbit, Monoclonal

Artikelnummer: ABC-A81038-100
Artikelname: Anti-Angiotensin Converting Enzyme 1 Antibody [ARC0577], Unconjugated, Rabbit, Monoclonal
Artikelnummer: ABC-A81038-100
Hersteller Artikelnummer: A81038-100
Alternativnummer: ABC-A81038-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IP, WB
Spezies Reaktivität: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1200-1306 of human ACE1 (P12821).
Konjugation: Unconjugated
Rabbit monoclonal [ARC0577] antibody to Angiotensin Converting Enzyme 1.
Klonalität: Monoclonal
Konzentration: Lot Specific
Klon-Bezeichnung: [ARC0577]
Molekulargewicht: 170 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: YFKPLLDWLRTENELHGEKLGWPQYNWTPNSARSEGPLPDSGRVSFLGLDLDAQQARVGQWLLLFLGIALLVATLGLSQRLFSIRHRSLHRHSHGPQFGSEVELRHS
Target-Kategorie: Angiotensin Converting Enzyme 1
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, IP: 1:500-1:1,000