Anti-delta 1 Catenin/CAS Antibody [ARC0586], Unconjugated, Rabbit, Monoclonal

Artikelnummer: ABC-A81041-100
Artikelname: Anti-delta 1 Catenin/CAS Antibody [ARC0586], Unconjugated, Rabbit, Monoclonal
Artikelnummer: ABC-A81041-100
Hersteller Artikelnummer: A81041-100
Alternativnummer: ABC-A81041-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 869-968 of human d-Catenin/p120 Catenin (O60716).
Konjugation: Unconjugated
Rabbit monoclonal [ARC0586] antibody to delta 1 Catenin/CAS.
Klonalität: Monoclonal
Konzentration: Lot Specific
Klon-Bezeichnung: [ARC0586]
Molekulargewicht: 100 kDa / 110 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: TLPLIDRNQKSDKKPDREEIQMSNMGSNTKSLDNNYSTPNERGDHNRTLDRSGDLGDMEPLKGTTPLMQDEGQESLEEELDVLVLDDEGGQVSYPSMQKI
Target-Kategorie: delta 1 Catenin/CAS
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, IHC: 1:100-1:500, IP: 1:500-1:1,000