Anti-HLA-A Antibody [ARC0588], Unconjugated, Rabbit, Monoclonal

Artikelnummer: ABC-A81042-100
Artikelname: Anti-HLA-A Antibody [ARC0588], Unconjugated, Rabbit, Monoclonal
Artikelnummer: ABC-A81042-100
Hersteller Artikelnummer: A81042-100
Alternativnummer: ABC-A81042-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, IP, WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HLA-A (P04439).
Konjugation: Unconjugated
Rabbit monoclonal [ARC0588] antibody to HLA-A.
Klonalität: Monoclonal
Konzentration: Lot Specific
Klon-Bezeichnung: [ARC0588]
Molekulargewicht: 41 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRV
Target-Kategorie: HLA-A
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, IHC: 1:50-1:200, IP: 1:1,000-1:5,000