Anti-Cdk4 Antibody [ARC51004], Unconjugated, Rabbit, Monoclonal

Artikelnummer: ABC-A81170-100
Artikelname: Anti-Cdk4 Antibody [ARC51004], Unconjugated, Rabbit, Monoclonal
Artikelnummer: ABC-A81170-100
Hersteller Artikelnummer: A81170-100
Alternativnummer: ABC-A81170-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Monkey, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 204-303 of human CDK4 (NP_000066.1).
Konjugation: Unconjugated
Rabbit monoclonal [ARC51004] antibody to Cdk4.
Klonalität: Monoclonal
Konzentration: Lot Specific
Klon-Bezeichnung: [ARC51004]
Molekulargewicht: 34 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.05% Proclin 300.
Formulierung: Liquid
Sequenz: FAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE
Target-Kategorie: Cdk4
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200