Anti-CD27 Antibody [ARC0625], Unconjugated, Rabbit, Monoclonal

Artikelnummer: ABC-A81178-100
Artikelname: Anti-CD27 Antibody [ARC0625], Unconjugated, Rabbit, Monoclonal
Artikelnummer: ABC-A81178-100
Hersteller Artikelnummer: A81178-100
Alternativnummer: ABC-A81178-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Human, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CD27 (P26842).
Konjugation: Unconjugated
Rabbit monoclonal [ARC0625] antibody to CD27.
Klonalität: Monoclonal
Konzentration: Lot Specific
Klon-Bezeichnung: [ARC0625]
Molekulargewicht: 55 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: MARPHPWWLCVLGTLVGLSATPAPKSCPERHYWAQGKLCCQMCEPGTFLVKDCDQHRKAAQCDPCIPGVSFSPDHHTRPHCESCRHCNSGLLVRNCTITA
Target-Kategorie: CD27
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, ICC/IF: 1:50-1:200