Anti-Catalase Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A81187-100
Artikelname: Anti-Catalase Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A81187-100
Hersteller Artikelnummer: A81187-100
Alternativnummer: ABC-A81187-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-225 of human Catalasealase (NP_001743.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Catalase.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 60 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: MADSRDPASDQMQHWKEQRAAQKADVLTTGAGNPVGDKLNVITVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFEVTHDITKYSKAKVFEHIGKKTPIAVRFSTVAGESGSADTVRDPRGFAVKFYTEDGNWDLVGNNTPIFFIRDPILFPSFIHSQKRNPQTHLKDPDMVWDFWSLRPESLHQVSFLFSDRGIPDGHRHMNGYGSHTFKLVNA
Target-Kategorie: Catalase
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000, IP: 1:20-1:50