Anti-Nestin Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A81194-100
Artikelname: Anti-Nestin Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A81194-100
Hersteller Artikelnummer: A81194-100
Alternativnummer: ABC-A81194-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1522-1621 of human NES (NP_006608.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Nestin.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 150 kDa / 177 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Formulierung: Liquid
Sequenz: GMEDAGPGADIIGVNGQGPNLEGKSQHVNGGVMNGLEQSEEVGQGMPLVSEGDRGSPFQEEEGSALKTSWAGAPVHLGQGQFLKFTQREGDRESWSSGED
Target-Kategorie: Nestin
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200