Anti-Thyroglobulin Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A81211-100
Artikelname: Anti-Thyroglobulin Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A81211-100
Hersteller Artikelnummer: A81211-100
Alternativnummer: ABC-A81211-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 365-540 of human Thyroglobulin (NP_003226.4).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Thyroglobulin.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 290 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: ASERQQALSRLYFGTSGYFSQHDLFSSPEKRWASPRVARFATSCPPTIKELFVDSGLLRPMVEGQSQQFSVSENLLKEAIRAIFPSRGLARLALQFTTNPKRLQQNLFGGKFLVNVGQFNLSGALGTRGTFNFSQFFQQLGLASFLNGGRQEDLAKPLSVGLDSNSSTGTPEAAKK
Target-Kategorie: Thyroglobulin
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, IHC: 1:50-1:200